TRIM67 anticorps (C-Term)

N° du produit ABIN631345

Détail du produit anti-TRIM67 anticorps

Antigène: TRIM67 (Tripartite Motif Containing 67 (TRIM67))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM67 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM67 antibody was raised against the C terminal of TRIM67

Purification: Affinity purified

Immunogène: TRIM67 antibody was raised using the C terminal of TRIM67 corresponding to a region with amino acids GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM67 Blocking Peptide, catalog no. 33R-3305, is also available for use as a blocking control in assays to test for specificity of this TRIM67 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM67 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM67

Antigène: TRIM67 (Tripartite Motif Containing 67 (TRIM67))

Autre désignation: TRIM67 (TRIM67 Produits)

Synonymes: anticorps TNL, anticorps D130049O21Rik, anticorps RGD1560667, anticorps tripartite motif containing 67, anticorps tripartite motif-containing 67, anticorps TRIM67, anticorps Trim67

Sujet: The specific function of TRIM67 is not yet known.

Poids moléculaire: 84 kDa (MW of target protein)