TRIM72 anticorps (N-Term)
-
- Antigène Voir toutes TRIM72 Anticorps
- TRIM72 (Tripartite Motif Containing 72 (TRIM72))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRIM72 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRIM72 antibody was raised against the N terminal of TRIM72
- Purification
- Affinity purified
- Immunogène
- TRIM72 antibody was raised using the N terminal of TRIM72 corresponding to a region with amino acids CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ
- Top Product
- Discover our top product TRIM72 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRIM72 Blocking Peptide, catalog no. 33R-1646, is also available for use as a blocking control in assays to test for specificity of this TRIM72 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM72 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRIM72 (Tripartite Motif Containing 72 (TRIM72))
- Autre désignation
- TRIM72 (TRIM72 Produits)
- Synonymes
- anticorps Trim72, anticorps MG53, anticorps Mg53, anticorps BC067209, anticorps RGD1562778, anticorps tripartite motif containing 72, anticorps tripartite motif containing 72, E3 ubiquitin protein ligase L homeolog, anticorps tripartite motif-containing 72, anticorps TRIM72, anticorps trim72.L, anticorps Trim72
- Sujet
- TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.
- Poids moléculaire
- 53 kDa (MW of target protein)
-