TRIM72 anticorps (N-Term)

N° du produit ABIN631346

Détail du produit anti-TRIM72 anticorps

Antigène: TRIM72 (Tripartite Motif Containing 72 (TRIM72))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM72 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM72 antibody was raised against the N terminal of TRIM72

Purification: Affinity purified

Immunogène: TRIM72 antibody was raised using the N terminal of TRIM72 corresponding to a region with amino acids CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM72 Blocking Peptide, catalog no. 33R-1646, is also available for use as a blocking control in assays to test for specificity of this TRIM72 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM72 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM72

Antigène: TRIM72 (Tripartite Motif Containing 72 (TRIM72))

Autre désignation: TRIM72 (TRIM72 Produits)

Synonymes: anticorps Trim72, anticorps MG53, anticorps Mg53, anticorps BC067209, anticorps RGD1562778, anticorps tripartite motif containing 72, anticorps tripartite motif containing 72, E3 ubiquitin protein ligase L homeolog, anticorps tripartite motif-containing 72, anticorps TRIM72, anticorps trim72.L, anticorps Trim72

Sujet: TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.

Poids moléculaire: 53 kDa (MW of target protein)