UBE2L6 anticorps (N-Term)
-
- Antigène Voir toutes UBE2L6 Anticorps
- UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBE2L6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UBE2 L6 antibody was raised against the N terminal of UBE2 6
- Purification
- Affinity purified
- Immunogène
- UBE2 L6 antibody was raised using the N terminal of UBE2 6 corresponding to a region with amino acids LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL
- Top Product
- Discover our top product UBE2L6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBE2L6 Blocking Peptide, catalog no. 33R-5160, is also available for use as a blocking control in assays to test for specificity of this UBE2L6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))
- Autre désignation
- UBE2L6 (UBE2L6 Produits)
- Synonymes
- anticorps UBE2L6, anticorps RIG-B, anticorps UBCH8, anticorps 2810489I21Rik, anticorps Ubce8, anticorps Ubcm8, anticorps UbcM8, anticorps ubiquitin conjugating enzyme E2 L6, anticorps ubiquitin-conjugating enzyme E2L 6, anticorps UBE2L6, anticorps Ube2l6
- Sujet
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene.
- Poids moléculaire
- 18 kDa (MW of target protein)
-