RFPL3 anticorps (C-Term)
-
- Antigène Tous les produits RFPL3
- RFPL3 (Ret Finger Protein-Like 3 (RFPL3))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RFPL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RFPL3 antibody was raised against the C terminal of RFPL3
- Purification
- Affinity purified
- Immunogène
- RFPL3 antibody was raised using the C terminal of RFPL3 corresponding to a region with amino acids TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RFPL3 Blocking Peptide, catalog no. 33R-9367, is also available for use as a blocking control in assays to test for specificity of this RFPL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RFPL3 (Ret Finger Protein-Like 3 (RFPL3))
- Autre désignation
- RFPL3 (RFPL3 Produits)
- Synonymes
- anticorps RFPL3, anticorps ret finger protein like 3, anticorps ret finger protein-like 3, anticorps RFPL3, anticorps LOC738758, anticorps LOC100349961, anticorps LOC100357271
- Sujet
- The function of RFPL3 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 32 kDa (MW of target protein)
-