RFPL3 anticorps (C-Term)

N° du produit ABIN631355

Détail du produit anti-RFPL3 anticorps

Antigène: RFPL3 (Ret Finger Protein-Like 3 (RFPL3))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFPL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: RFPL3 antibody was raised against the C terminal of RFPL3

Purification: Affinity purified

Immunogène: RFPL3 antibody was raised using the C terminal of RFPL3 corresponding to a region with amino acids TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFPL3 Blocking Peptide, catalog no. 33R-9367, is also available for use as a blocking control in assays to test for specificity of this RFPL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFPL3

Antigène: RFPL3 (Ret Finger Protein-Like 3 (RFPL3))

Autre désignation: RFPL3 (RFPL3 Produits)

Synonymes: anticorps RFPL3, anticorps ret finger protein like 3, anticorps ret finger protein-like 3, anticorps RFPL3, anticorps LOC738758, anticorps LOC100349961, anticorps LOC100357271

Sujet: The function of RFPL3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 32 kDa (MW of target protein)