WWP2 anticorps (Middle Region)

N° du produit ABIN631357

Détail du produit anti-WWP2 anticorps

Antigène: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Épitope: Middle Region

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WWP2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: WWP2 antibody was raised against the middle region of WWP2

Purification: Affinity purified

Immunogène: WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WWP2 Blocking Peptide, catalog no. 33R-2586, is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WWP2

Antigène: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Autre désignation: WWP2 (WWP2 Produits)

Synonymes: anticorps aip2, anticorps wwp2-like, anticorps id:ibd1121, anticorps wu:fo87e10, anticorps zgc:154036, anticorps AIP2, anticorps WWp2-like, anticorps 1300010O06Rik, anticorps AA690238, anticorps AW554328, anticorps WW domain containing E3 ubiquitin protein ligase 2, anticorps WWP2, anticorps wwp2, anticorps Wwp2

Sujet: WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity