FBXW2 anticorps (Middle Region)
-
- Antigène Voir toutes FBXW2 Anticorps
- FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXW2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXW2 antibody was raised against the middle region of FBXW2
- Purification
- Affinity purified
- Immunogène
- FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI
- Top Product
- Discover our top product FBXW2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXW2 Blocking Peptide, catalog no. 33R-8600, is also available for use as a blocking control in assays to test for specificity of this FBXW2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))
- Autre désignation
- FBXW2 (FBXW2 Produits)
- Synonymes
- anticorps FBXW2, anticorps md6, anticorps fbw2, anticorps fwd2, anticorps MGC53244, anticorps FBW2, anticorps Fwd2, anticorps Md6, anticorps wu:fc72f10, anticorps zgc:110365, anticorps 2700071L08Rik, anticorps MD6, anticorps F-box and WD repeat domain containing 2, anticorps F-box and WD repeat domain containing 2 L homeolog, anticorps F-box and WD-40 domain protein 2, anticorps FBXW2, anticorps fbxw2, anticorps Fbxw2, anticorps fbxw2.L
- Sujet
- F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins.
- Poids moléculaire
- 51 kDa (MW of target protein)
-