FBXO25 anticorps (N-Term)
-
- Antigène Voir toutes FBXO25 Anticorps
- FBXO25 (F-Box Protein 25 (FBXO25))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO25 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO25 antibody was raised against the N terminal of FBXO25
- Purification
- Affinity purified
- Immunogène
- FBXO25 antibody was raised using the N terminal of FBXO25 corresponding to a region with amino acids LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL
- Top Product
- Discover our top product FBXO25 Anticorps primaire
-
anti-F-Box Protein 25 (FBXO25) (AA 1-291) antibody
FBXO25 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 25 (FBXO25) (AA 1-367) antibodyFBXO25 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2F1 unconjugated
anti-F-Box Protein 25 (FBXO25) (C-Term) antibodyFBXO25 Reactivité: Humain, Poisson zèbre (Danio rerio), Chien, Cheval, Cobaye, Singe, Poulet, Roussette (Chauve-souris) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 25 (FBXO25) (C-Term) antibodyFBXO25 Reactivité: Humain, Poisson zèbre (Danio rerio), Chien WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 25 (FBXO25) antibodyFBXO25 Reactivité: Humain, Souris WB Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 25 (FBXO25) (AA 142-291) antibodyFBXO25 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 25 (FBXO25) (AA 36-85) antibodyFBXO25 Reactivité: Humain, Cheval, Boeuf (Vache), Singe, Poulet WB Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 25 (FBXO25) (C-Term) antibodyFBXO25 Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien, Cheval, Cobaye, Boeuf (Vache), Lapin WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 25 (FBXO25) (N-Term) antibodyFBXO25 Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien, Cheval, Cobaye, Boeuf (Vache), Lapin, Porc WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO25 Blocking Peptide, catalog no. 33R-4968, is also available for use as a blocking control in assays to test for specificity of this FBXO25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO25 (F-Box Protein 25 (FBXO25))
- Autre désignation
- FBXO25 (FBXO25 Produits)
- Synonymes
- anticorps FBXO25, anticorps fbxo32, anticorps MGC108443, anticorps DKFZp469H2437, anticorps zgc:100907, anticorps FBX25, anticorps 9130015I06Rik, anticorps AI649137, anticorps Fbx25, anticorps F-box protein 25, anticorps F-box protein 25 L homeolog, anticorps FBXO25, anticorps fbxo25, anticorps fbxo25.L, anticorps Fbxo25
- Sujet
- FBXO25 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.
- Poids moléculaire
- 34 kDa (MW of target protein)
-
