F-Box Protein 3 anticorps (N-Term)

N° du produit ABIN631362

Détail du produit anti-F-Box Protein 3 anticorps

Antigène: F-Box Protein 3 (FBXO3)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp F-Box Protein 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO3 antibody was raised against the N terminal of FBXO3

Purification: Affinity purified

Immunogène: FBXO3 antibody was raised using the N terminal of FBXO3 corresponding to a region with amino acids NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO3 Blocking Peptide, catalog no. 33R-6651, is also available for use as a blocking control in assays to test for specificity of this FBXO3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur F-Box Protein 3

Antigène: F-Box Protein 3 (FBXO3)

Autre désignation: FBXO3 (FBXO3 Produits)

Synonymes: anticorps FBA, anticorps FBX3, anticorps 1200002G09Rik, anticorps 1700026K02Rik, anticorps AI046358, anticorps Fba, anticorps zgc:112485, anticorps DKFZp459H187, anticorps F-box protein 3, anticorps F-box protein 3 S homeolog, anticorps FBXO3, anticorps Fbxo3, anticorps fbxo3.S, anticorps fbxo3

Sujet: FBXO3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO3 belongs to the Fbxs class.

Poids moléculaire: 47 kDa (MW of target protein)