FBXO5 anticorps (C-Term)

N° du produit ABIN631366

Détail du produit anti-FBXO5 anticorps

Antigène: FBXO5 (F-Box Protein 5 (FBXO5))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO5 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO5 antibody was raised against the C terminal of FBXO5

Purification: Affinity purified

Immunogène: FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO5 Blocking Peptide, catalog no. 33R-1541, is also available for use as a blocking control in assays to test for specificity of this FBXO5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO5

Antigène: FBXO5 (F-Box Protein 5 (FBXO5))

Autre désignation: FBXO5 (FBXO5 Produits)

Synonymes: anticorps EMI1, anticorps FBX5, anticorps Fbxo31, anticorps 2510044I10Rik, anticorps C85305, anticorps Emi1, anticorps emi1, anticorps fc65h02, anticorps wu:fc65h02, anticorps wu:fe06e07, anticorps wu:fz79f03, anticorps zgc:136397, anticorps zgc:158541, anticorps fbx5, anticorps Fbxo5, anticorps ACYPI007854, anticorps fbxo5, anticorps F-box protein 5, anticorps F-box only protein 5, anticorps F-box protein 5 L homeolog, anticorps F-box protein 5 S homeolog, anticorps FBXO5, anticorps Fbxo5, anticorps fbxo5, anticorps fbxo5.L, anticorps fbxo5.S

Sujet: FBXO5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases