FBXW11 anticorps (N-Term)
-
- Antigène Voir toutes FBXW11 Anticorps
- FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXW11 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXW11 antibody was raised against the N terminal of FBXW11
- Purification
- Affinity purified
- Immunogène
- FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD
- Top Product
- Discover our top product FBXW11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXW11 Blocking Peptide, catalog no. 33R-1744, is also available for use as a blocking control in assays to test for specificity of this FBXW11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))
- Autre désignation
- FBXW11 (FBXW11 Produits)
- Synonymes
- anticorps BTRC2, anticorps BTRCP2, anticorps FBW1B, anticorps FBXW1B, anticorps Fbw11, anticorps Hos, anticorps 2310065A07Rik, anticorps AA536858, anticorps Fbxw1b, anticorps HOS, anticorps btrc2, anticorps fbxw11a, anticorps wu:fa12e12, anticorps wu:fb11f03, anticorps zgc:63728, anticorps fbxw11, anticorps fbxw11b, anticorps fbxw1b, anticorps wu:fd14d12, anticorps wu:fi43f07, anticorps F-box and WD repeat domain containing 11, anticorps F-box and WD-40 domain protein 11, anticorps F-box/WD repeat-containing protein 11, anticorps F-box and WD repeat domain containing 11b, anticorps F-box and WD repeat domain containing 11a, anticorps FBXW11, anticorps Fbxw11, anticorps LOC100199403, anticorps fbxw11b, anticorps fbxw11a
- Sujet
- FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats.
- Poids moléculaire
- 62 kDa (MW of target protein)
-