UBE2S anticorps (N-Term)

N° du produit ABIN631371

Détail du produit anti-UBE2S anticorps

Antigène: UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2S est non-conjugé

Application: Western Blotting (WB)

Specificité: UBE2 S antibody was raised against the N terminal of UBE2

Purification: Affinity purified

Immunogène: UBE2 S antibody was raised using the N terminal of UBE2 corresponding to a region with amino acids NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2S Blocking Peptide, catalog no. 33R-6884, is also available for use as a blocking control in assays to test for specificity of this UBE2S antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2S

Antigène: UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))

Autre désignation: UBE2S (UBE2S Produits)

Synonymes: anticorps E2-EPF, anticorps E2EPF, anticorps EPF5, anticorps 0910001J09Rik, anticorps 6720465F12Rik, anticorps AA409170, anticorps RGD1564746, anticorps ube2s, anticorps UBE2S, anticorps DDBDRAFT_0188215, anticorps DDBDRAFT_0305006, anticorps DDB_0188215, anticorps DDB_0305006, anticorps e2-epf, anticorps e2epf, anticorps epf5, anticorps ube2s.1, anticorps ube2s.1-b, anticorps ube2s.1-a, anticorps ubiquitin conjugating enzyme E2 S, anticorps ubiquitin-conjugating enzyme E2S, anticorps ubiquitin-conjugating enzyme e2S, putative, anticorps ubiquitin-conjugating enzyme E2 S, anticorps ubiquitin conjugating enzyme E2 S S homeolog, anticorps ubiquitin conjugating enzyme E2 S L homeolog, anticorps UBE2S, anticorps Ube2s, anticorps ube2s, anticorps ATEG_00324, anticorps Smp_180170, anticorps MCYG_01532, anticorps ube2s.S, anticorps ube2s.L

Sujet: UBE2S is a member of the ubiquitin-conjugating enzyme family. It is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway