RC3H2 anticorps (Middle Region)

N° du produit ABIN631375

Détail du produit anti-RC3H2 anticorps

Antigène: RC3H2 (Membrane Associated DNA Binding Protein (RC3H2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RC3H2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RC3 H2 antibody was raised against the middle region of RC3 2

Purification: Affinity purified

Immunogène: RC3 H2 antibody was raised using the middle region of RC3 2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RC3H2 Blocking Peptide, catalog no. 33R-10248, is also available for use as a blocking control in assays to test for specificity of this RC3H2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RC0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RC3H2

Antigène: RC3H2 (Membrane Associated DNA Binding Protein (RC3H2))

Autre désignation: RC3H2 (RC3H2 Produits)

Synonymes: anticorps Mnab, anticorps MNAB, anticorps RNF164, anticorps 2900024N03Rik, anticorps 9430019J22Rik, anticorps D930043C02Rik, anticorps Rnf164, anticorps ring finger and CCCH-type domains 2, anticorps ring finger and CCCH-type zinc finger domains 2, anticorps Rc3h2, anticorps RC3H2

Sujet: The function of RC3H2 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 118 kDa (MW of target protein)