RSPRY1 anticorps (N-Term)

N° du produit ABIN631386

Détail du produit anti-RSPRY1 anticorps

Antigène: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSPRY1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RSPRY1 antibody was raised against the N terminal of RSPRY1

Purification: Affinity purified

Immunogène: RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RSPRY1 Blocking Peptide, catalog no. 33R-8205, is also available for use as a blocking control in assays to test for specificity of this RSPRY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPRY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSPRY1

Antigène: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Autre désignation: RSPRY1 (RSPRY1 Produits)

Synonymes: anticorps si:ch211-257c9.1, anticorps 4930470D19Rik, anticorps AI608258, anticorps RGD1308847, anticorps ring finger and SPRY domain containing 1, anticorps ring finger and SPRY domain containing 1 S homeolog, anticorps RSPRY1, anticorps rspry1, anticorps rspry1.S, anticorps Rspry1

Sujet: RSPRY1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of RSPRY1 remains unknown.

Poids moléculaire: 64 kDa (MW of target protein)