RSPRY1 anticorps (N-Term)
-
- Antigène Tous les produits RSPRY1
- RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RSPRY1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RSPRY1 antibody was raised against the N terminal of RSPRY1
- Purification
- Affinity purified
- Immunogène
- RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RSPRY1 Blocking Peptide, catalog no. 33R-8205, is also available for use as a blocking control in assays to test for specificity of this RSPRY1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPRY1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))
- Autre désignation
- RSPRY1 (RSPRY1 Produits)
- Synonymes
- anticorps si:ch211-257c9.1, anticorps 4930470D19Rik, anticorps AI608258, anticorps RGD1308847, anticorps ring finger and SPRY domain containing 1, anticorps ring finger and SPRY domain containing 1 S homeolog, anticorps RSPRY1, anticorps rspry1, anticorps rspry1.S, anticorps Rspry1
- Sujet
- RSPRY1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of RSPRY1 remains unknown.
- Poids moléculaire
- 64 kDa (MW of target protein)
-