TRIM43 anticorps (C-Term)
-
- Antigène Tous les produits TRIM43
- TRIM43 (Tripartite Motif Containing 43 (TRIM43))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRIM43 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRIM43 antibody was raised against the C terminal of TRIM43
- Purification
- Affinity purified
- Immunogène
- TRIM43 antibody was raised using the C terminal of TRIM43 corresponding to a region with amino acids NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRIM43 Blocking Peptide, catalog no. 33R-6890, is also available for use as a blocking control in assays to test for specificity of this TRIM43 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM43 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRIM43 (Tripartite Motif Containing 43 (TRIM43))
- Autre désignation
- TRIM43 (TRIM43 Produits)
- Synonymes
- anticorps TRIM43A, anticorps tripartite motif containing 43, anticorps TRIM43
- Sujet
- TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.
- Poids moléculaire
- 52 kDa (MW of target protein)
-