TRIM42 anticorps (C-Term)

N° du produit ABIN631389

Détail du produit anti-TRIM42 anticorps

Antigène: TRIM42 (Tripartite Motif Containing 42 (TRIM42))

Épitope: C-Term

Reactivité: Humain, Chien, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM42 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM42 antibody was raised against the C terminal of TRIM42

Purification: Affinity purified

Immunogène: TRIM42 antibody was raised using the C terminal of TRIM42 corresponding to a region with amino acids VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM42 Blocking Peptide, catalog no. 33R-9638, is also available for use as a blocking control in assays to test for specificity of this TRIM42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM42

Antigène: TRIM42 (Tripartite Motif Containing 42 (TRIM42))

Autre désignation: TRIM42 (TRIM42 Produits)

Synonymes: anticorps TRIM42, anticorps PPP1R40, anticorps 4930486B16Rik, anticorps tripartite motif containing 42, anticorps tripartite motif-containing 42, anticorps TRIM42, anticorps Trim42

Sujet: TRIM42 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.

Poids moléculaire: 80 kDa (MW of target protein)