RNF168 anticorps (C-Term)
-
- Antigène Voir toutes RNF168 Anticorps
- RNF168 (Ring Finger Protein 168 (RNF168))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Chien, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF168 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RNF168 antibody was raised against the C terminal of RNF168
- Purification
- Affinity purified
- Immunogène
- RNF168 antibody was raised using the C terminal of RNF168 corresponding to a region with amino acids PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA
- Top Product
- Discover our top product RNF168 Anticorps primaire
-
anti-Ring Finger Protein 168 (RNF168) (AA 462-571) antibody
RNF168 Reactivité: Humain WB, ELISA, IF, IHC (p) Hôte: Souris Monoclonal 3E1 unconjugated
anti-Ring Finger Protein 168 (RNF168) (AA 1-571) antibodyRNF168 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 168 (RNF168) (AA 1-571) antibodyRNF168 Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Ring Finger Protein 168 (RNF168) (AA 401-450) antibodyRNF168 Reactivité: Humain, Souris, Chien, Rat, Cobaye, Lapin, Hamster, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 168 (RNF168) (C-Term) antibodyRNF168 Reactivité: Humain, Souris, Chien, Rat, Cobaye, Lapin, Boeuf (Vache), Cheval WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 168 (RNF168) (AA 194-296) antibodyRNF168 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 168 (RNF168) (AA 468-496), (C-Term) antibodyRNF168 Reactivité: Humain WB Hôte: Lapin Polyclonal RB37281 unconjugated
anti-Ring Finger Protein 168 (RNF168) (AA 300-571) antibodyRNF168 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 168 (RNF168) (C-Term) antibodyRNF168 Reactivité: Humain, Souris WB, EIA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF168 Blocking Peptide, catalog no. 33R-6996, is also available for use as a blocking control in assays to test for specificity of this RNF168 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF168 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF168 (Ring Finger Protein 168 (RNF168))
- Autre désignation
- RNF168 (RNF168 Produits)
- Synonymes
- anticorps 3110001H15Rik, anticorps hRNF168, anticorps ring finger protein 168, anticorps ring finger protein 168, E3 ubiquitin protein ligase L homeolog, anticorps Rnf168, anticorps rnf168.L, anticorps RNF168
- Sujet
- The complex repair response elicited by DNA double-strand breaks (DSBs) includes recruitment of several DNA repair proteins and ubiquitination of H2A-type histones. RNF168 is an E3 ubiquitin ligase critical for DSB repair.
- Poids moléculaire
- 65 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-
