HECTD2 anticorps (C-Term)

N° du produit ABIN631394

Détail du produit anti-HECTD2 anticorps

Antigène: HECTD2 (HECT Domain Containing 2 (HECTD2))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HECTD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: HECTD2 antibody was raised against the C terminal of HECTD2

Purification: Affinity purified

Immunogène: HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HECTD2 Blocking Peptide, catalog no. 33R-9013, is also available for use as a blocking control in assays to test for specificity of this HECTD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECTD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HECTD2

Antigène: HECTD2 (HECT Domain Containing 2 (HECTD2))

Autre désignation: HECTD2 (HECTD2 Produits)

Synonymes: anticorps hmm77879, anticorps HECTD2, anticorps DKFZp459J1430, anticorps 4921524L07, anticorps A630025O09Rik, anticorps AW212605, anticorps HECT domain E3 ubiquitin protein ligase 2, anticorps HECT domain containing E3 ubiquitin protein ligase 2, anticorps Probable E3 ubiquitin-protein ligase HECTD2, anticorps HECT domain containing 2, anticorps HECTD2, anticorps hectd2, anticorps hecd2, anticorps Hectd2

Sujet: HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Poids moléculaire: 88 kDa (MW of target protein)