PNPLA5 anticorps (C-Term)

N° du produit ABIN631400

Détail du produit anti-PNPLA5 anticorps

Antigène: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNPLA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PNPLA5 antibody was raised against the C terminal of PNPLA5

Purification: Affinity purified

Immunogène: PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNPLA5 Blocking Peptide, catalog no. 33R-6789, is also available for use as a blocking control in assays to test for specificity of this PNPLA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNPLA5

Antigène: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Autre désignation: PNPLA5 (PNPLA5 Produits)

Synonymes: anticorps GS2L, anticorps dJ388M5, anticorps dJ388M5.4, anticorps 4833426H19Rik, anticorps patatin like phospholipase domain containing 5, anticorps patatin-like phospholipase domain containing 5, anticorps PNPLA5, anticorps Pnpla5

Sujet: Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.

Poids moléculaire: 48 kDa (MW of target protein)