TRMT61A anticorps (N-Term)

N° du produit ABIN631401

Détail du produit anti-TRMT61A anticorps

Antigène: TRMT61A (tRNA Methyltransferase 61 Homolog A (TRMT61A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRMT61A est non-conjugé

Application: Western Blotting (WB)

Specificité: C14 ORF172 antibody was raised against the N terminal Of C14 rf172

Purification: Affinity purified

Immunogène: C14 ORF172 antibody was raised using the N terminal Of C14 rf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF172 Blocking Peptide, catalog no. 33R-6422, is also available for use as a blocking control in assays to test for specificity of this C14ORF172 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF172 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRMT61A

Antigène: TRMT61A (tRNA Methyltransferase 61 Homolog A (TRMT61A))

Autre désignation: C14ORF172 (TRMT61A Produits)

Synonymes: anticorps C14orf172, anticorps GCD14, anticorps Gcd14p, anticorps TRM61, anticorps hTRM61, anticorps Gcd14, anticorps RGD1359191, anticorps Trm61, anticorps 6720458F09Rik, anticorps AI606093, anticorps zgc:86657, anticorps tRNA methyltransferase 61A, anticorps TRMT61A, anticorps Trmt61a, anticorps trmt61a

Sujet: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 31 kDa (MW of target protein)