VPS37A anticorps
-
- Antigène Voir toutes VPS37A Anticorps
- VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VPS37A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- VPS37 A antibody was raised using a synthetic peptide corresponding to a region with amino acids SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE
- Top Product
- Discover our top product VPS37A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VPS37A Blocking Peptide, catalog no. 33R-8941, is also available for use as a blocking control in assays to test for specificity of this VPS37A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))
- Autre désignation
- VPS37A (VPS37A Produits)
- Synonymes
- anticorps fb08f03, anticorps fj42c03, anticorps zgc:73244, anticorps zgc:77637, anticorps wu:fb08f03, anticorps wu:fj42c03, anticorps HCRP1, anticorps PQBP2, anticorps SPG53, anticorps 2210018P21Rik, anticorps 4930592A21Rik, anticorps AW261445, anticorps D8Ertd531e, anticorps vacuolar protein sorting 37A, anticorps VPS37A, ESCRT-I subunit, anticorps vacuolar protein sorting 37 homolog A, anticorps vacuolar protein sorting 37 homolog A L homeolog, anticorps vps37a, anticorps VPS37A, anticorps vps37a.L, anticorps Vps37a
- Sujet
- VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.
- Poids moléculaire
- 44 kDa (MW of target protein)
-