KLHL15 anticorps
-
- Antigène Voir toutes KLHL15 Anticorps
- KLHL15 (Kelch-Like 15 (KLHL15))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLHL15 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- KLHL15 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC
- Top Product
- Discover our top product KLHL15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLHL15 Blocking Peptide, catalog no. 33R-9645, is also available for use as a blocking control in assays to test for specificity of this KLHL15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLHL15 (Kelch-Like 15 (KLHL15))
- Autre désignation
- KLHL15 (KLHL15 Produits)
- Synonymes
- anticorps 6330500C13Rik, anticorps wu:fa66h10, anticorps zgc:101051, anticorps RGD1563101, anticorps kelch-like 15, anticorps kelch-like family member 15, anticorps kelch like family member 15, anticorps Klhl15, anticorps klhl15, anticorps KLHL15
- Sujet
- KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.
- Poids moléculaire
- 66 kDa (MW of target protein)
-