alpha Actinin 4 anticorps (C-Term)
-
- Antigène Voir toutes alpha Actinin 4 (ACTN4) Anticorps
- alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp alpha Actinin 4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Alpha Actinin 4 antibody was raised against the C terminal of ACTN4
- Purification
- Affinity purified
- Immunogène
- alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI
- Top Product
- Discover our top product ACTN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Alpha Actinin 4 Blocking Peptide, catalog no. 33R-2213, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))
- Autre désignation
- alpha Actinin 4 (ACTN4 Produits)
- Synonymes
- anticorps fsgs, anticorps fsgs1, anticorps C77391, anticorps ACTININ-4, anticorps FSGS, anticorps FSGS1, anticorps wu:fb53f05, anticorps zgc:63508, anticorps actinin alpha 4, anticorps actinin, alpha 4, anticorps actinin alpha 4 S homeolog, anticorps actn4, anticorps ACTN4, anticorps Actn4, anticorps actn4.S
- Sujet
- Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.
- Poids moléculaire
- 105 kDa (MW of target protein)
- Pathways
- Proton Transport
-