AMOTL1 anticorps (N-Term)

N° du produit ABIN631414

Détail du produit anti-AMOTL1 anticorps

Antigène: AMOTL1 (Angiomotin Like 1 (AMOTL1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMOTL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: AMOTL1 antibody was raised against the N terminal of AMOTL1

Purification: Affinity purified

Immunogène: AMOTL1 antibody was raised using the N terminal of AMOTL1 corresponding to a region with amino acids LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMOTL1 Blocking Peptide, catalog no. 33R-5487, is also available for use as a blocking control in assays to test for specificity of this AMOTL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMOTL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AMOTL1

Antigène: AMOTL1 (Angiomotin Like 1 (AMOTL1))

Autre désignation: AMOTL1 (AMOTL1 Produits)

Synonymes: anticorps JEAP, anticorps 2310010G08Rik, anticorps 2310067L22Rik, anticorps 4932416D09Rik, anticorps mFLJ00155, anticorps angiomotin like 1, anticorps angiomotin-like 1, anticorps AMOTL1, anticorps Amotl1

Sujet: AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.

Poids moléculaire: 106 kDa (MW of target protein)