Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6) anticorps

N° du produit ABIN631415

Détail du produit

Antigène: Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HS3 ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HS3ST6 Blocking Peptide, catalog no. 33R-3249, is also available for use as a blocking control in assays to test for specificity of this HS3ST6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6)

Autre désignation: HS3ST6 (HS3ST6 Produits)

Synonymes: anticorps HS3ST5, anticorps heparan sulfate-glucosamine 3-sulfotransferase 6, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 6, anticorps HS3ST6, anticorps Hs3st6

Sujet: HS3ST6 is a single-pass type II membrane protein. It belongs to the sulfotransferase 1 family. It transfers a sulfuryl group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process