Copine IV anticorps (N-Term)

N° du produit ABIN631417

Détail du produit anti-Copine IV anticorps

Antigène: Copine IV (CPNE4)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Copine IV est non-conjugé

Application: Western Blotting (WB)

Specificité: Copine IV antibody was raised against the N terminal of CPNE4

Purification: Affinity purified

Immunogène: Copine IV antibody was raised using the N terminal of CPNE4 corresponding to a region with amino acids EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Copine IV Blocking Peptide, catalog no. 33R-2252, is also available for use as a blocking control in assays to test for specificity of this Copine IV antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Copine IV

Antigène: Copine IV (CPNE4)

Autre désignation: Copine IV (CPNE4 Produits)

Synonymes: anticorps CPNE4, anticorps COPN4, anticorps CPN4, anticorps 3632411M23Rik, anticorps 4933406O10Rik, anticorps si:dkey-5n4.1, anticorps copine 4, anticorps copine IV, anticorps copine IVb, anticorps CPNE4, anticorps cpne4, anticorps Cpne4, anticorps cpne4b

Sujet: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm.

Poids moléculaire: 62 kDa (MW of target protein)