TNKS anticorps (Middle Region)
-
- Antigène Voir toutes TNKS Anticorps
- TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TNKS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TNKS antibody was raised against the middle region of TNKS
- Purification
- Affinity purified
- Immunogène
- TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST
- Top Product
- Discover our top product TNKS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TNKS Blocking Peptide, catalog no. 33R-5048, is also available for use as a blocking control in assays to test for specificity of this TNKS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))
- Autre désignation
- TNKS (TNKS Produits)
- Synonymes
- anticorps wu:fe02c12, anticorps ARTD5, anticorps PARP-5a, anticorps PARP5A, anticorps PARPL, anticorps TIN1, anticorps TINF1, anticorps TNKS1, anticorps pART5, anticorps 4930554K12Rik, anticorps AI662855, anticorps C86528, anticorps D130072O21Rik, anticorps TANK1, anticorps mTNKS1, anticorps tankyrase-1, anticorps tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase b, anticorps tankyrase, anticorps tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase, anticorps tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 S homeolog, anticorps tnksb, anticorps TNKS, anticorps Tnks, anticorps tnks2.S
- Sujet
- TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.
- Poids moléculaire
- 142 kDa (MW of target protein)
-