GSTM5 anticorps (N-Term)
-
- Antigène Voir toutes GSTM5 Anticorps
- GSTM5 (Glutathione S-Transferase mu 5 (GSTM5))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GSTM5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GSTM5 antibody was raised against the N terminal of GSTM5
- Purification
- Affinity purified
- Immunogène
- GSTM5 antibody was raised using the N terminal of GSTM5 corresponding to a region with amino acids MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK
- Top Product
- Discover our top product GSTM5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GSTM5 Blocking Peptide, catalog no. 33R-6298, is also available for use as a blocking control in assays to test for specificity of this GSTM5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GSTM5 (Glutathione S-Transferase mu 5 (GSTM5))
- Autre désignation
- GSTM5 (GSTM5 Produits)
- Synonymes
- anticorps GSTM5-5, anticorps GTM5, anticorps glutathione S-transferase mu 5, anticorps glutathione S-transferase, mu 5, anticorps GSTM5, anticorps Gstm5
- Sujet
- Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.
- Poids moléculaire
- 26 kDa (MW of target protein)
-