B3GNT4 anticorps (N-Term)

N° du produit ABIN631426

Détail du produit anti-B3GNT4 anticorps

Antigène: B3GNT4 (beta-1,3-N-Acetylglucosaminyltransferase 4 (B3GNT4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B3GNT4 est non-conjugé

Application: Western Blotting (WB)

Specificité: B3 GNT4 antibody was raised against the N terminal of B3 NT4

Purification: Affinity purified

Immunogène: B3 GNT4 antibody was raised using the N terminal of B3 NT4 corresponding to a region with amino acids MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B3GNT4 Blocking Peptide, catalog no. 33R-6200, is also available for use as a blocking control in assays to test for specificity of this B3GNT4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 NT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B3GNT4

Antigène: B3GNT4 (beta-1,3-N-Acetylglucosaminyltransferase 4 (B3GNT4))

Autre désignation: B3GNT4 (B3GNT4 Produits)

Synonymes: anticorps B3GN-T4, anticorps beta3Gn-T4, anticorps 1010001G17Rik, anticorps BGnT-4, anticorps UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4, anticorps B3GNT4, anticorps B3gnt4

Sujet: B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.

Poids moléculaire: 42 kDa (MW of target protein)