Pallidin anticorps
-
- Antigène Voir toutes Pallidin (PLDN) Anticorps
- Pallidin (PLDN) (Pallidin Homolog (PLDN))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Pallidin est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL
- Top Product
- Discover our top product PLDN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLDN Blocking Peptide, catalog no. 33R-2437, is also available for use as a blocking control in assays to test for specificity of this PLDN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLDN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Pallidin (PLDN) (Pallidin Homolog (PLDN))
- Autre désignation
- PLDN (PLDN Produits)
- Synonymes
- anticorps CG14133, anticorps Dmel\\CG14133, anticorps LOC100226487, anticorps pldn, anticorps BLOS6, anticorps HPS9, anticorps PA, anticorps PALLID, anticorps PLDN, anticorps Pldn, anticorps BLOC-1, anticorps Stx13bp1, anticorps pa, anticorps pallidin, anticorps CG14133 gene product from transcript CG14133-RB, anticorps biogenesis of lysosomal organelles complex 1 subunit 6, anticorps pallidin homolog (mouse), anticorps biogenesis of lysosomal organelles complex-1, subunit 6, pallidin, anticorps Pallidin, anticorps BLOC1S6, anticorps pldn, anticorps Bloc1s6
- Sujet
- PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.
- Poids moléculaire
- 20 kDa (MW of target protein)
- Pathways
- Synaptic Vesicle Exocytosis
-