RAB1A anticorps (Middle Region)

N° du produit ABIN631433

Détail du produit anti-RAB1A anticorps

Antigène: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB1A est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB1 A antibody was raised against the middle region of RAB1

Purification: Affinity purified

Immunogène: RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB1A Blocking Peptide, catalog no. 33R-1303, is also available for use as a blocking control in assays to test for specificity of this RAB1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB1A

Antigène: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Autre désignation: RAB1A (RAB1A Produits)

Synonymes: anticorps RAB1, anticorps YPT1, anticorps RAS, anticorps RAB1B, anticorps fb53a02, anticorps oncogene, anticorps wu:fb53a02, anticorps si:zc101n13.3, anticorps rab1, anticorps MGC53138, anticorps RAB1A, anticorps AAF55873, anticorps CG3320, anticorps DRAB1, anticorps DRab1, anticorps Dm Rab1, anticorps DmRab1, anticorps Dmel\\CG3320, anticorps RAB1a, anticorps Rab1a, anticorps dRab1, anticorps dar6, anticorps drab1, anticorps DDBDRAFT_0185730, anticorps DDBDRAFT_0191476, anticorps DDB_0185730, anticorps DDB_0191476, anticorps Gtbp, anticorps Rab-1, anticorps Rab1A, anticorps Ypt1, anticorps mKIAA3012, anticorps Ac2-048, anticorps Rab1, anticorps Rab1r, anticorps RAB1A, member RAS oncogene family, anticorps RAB1A, member RAS oncogene family b, anticorps RAB1A, member RAS oncogene family L homeolog, anticorps RAB1B, member RAS oncogene family, anticorps CG3320 gene product from transcript CG3320-RA, anticorps rab1A protein, anticorps PfRab1a, anticorps hypothetical protein, anticorps Rab GTPase, anticorps angiogenin, anticorps RAB1A, anticorps rab1ab, anticorps rab1a.L, anticorps RAB1B, anticorps rab1a, anticorps Rab1, anticorps rab1A, anticorps Rab1a, anticorps ANG

Sujet: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome