ASL anticorps (N-Term)

N° du produit ABIN631440

Détail du produit anti-ASL anticorps

Antigène: ASL (Argininosuccinate Lyase (ASL))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASL est non-conjugé

Application: Western Blotting (WB)

Specificité: ASL antibody was raised against the N terminal of ASL

Purification: Affinity purified

Immunogène: ASL antibody was raised using the N terminal of ASL corresponding to a region with amino acids GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASL Blocking Peptide, catalog no. 33R-3175, is also available for use as a blocking control in assays to test for specificity of this ASL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASL

Antigène: ASL (Argininosuccinate Lyase (ASL))

Autre désignation: ASL (ASL Produits)

Synonymes: anticorps ASAL, anticorps 2510006M18Rik, anticorps zgc:63532, anticorps BA4879, anticorps PSPTO0125, anticorps Adl, anticorps Asl, anticorps argininosuccinate lyase, anticorps argininosuccinate lyase ArgH, anticorps adenylosuccinate lyase, anticorps argininosuccinate lyase L homeolog, anticorps ASL, anticorps Asl, anticorps asl, anticorps argH2, anticorps argH, anticorps arg7, anticorps CNC04420, anticorps STHERM_c13370, anticorps Adsl, anticorps asl.L, anticorps ARG7

Sujet: ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus