BAAT anticorps (N-Term)

N° du produit ABIN631444

Détail du produit anti-BAAT anticorps

Antigène: BAAT (Bile Acid CoA: Amino Acid N-Acyltransferase (Glycine N-Choloyltransferase) (BAAT))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BAAT est non-conjugé

Application: Western Blotting (WB)

Specificité: BAAT antibody was raised against the N terminal of BAAT

Purification: Affinity purified

Immunogène: BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BAAT Blocking Peptide, catalog no. 33R-4118, is also available for use as a blocking control in assays to test for specificity of this BAAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BAAT

Antigène: BAAT (Bile Acid CoA: Amino Acid N-Acyltransferase (Glycine N-Choloyltransferase) (BAAT))

Autre désignation: BAAT (BAAT Produits)

Synonymes: anticorps BACAT, anticorps BAT, anticorps AI118337, anticorps AI158864, anticorps kan-1, anticorps BAAT, anticorps bile acid-CoA:amino acid N-acyltransferase, anticorps Bile acid-CoA:amino acid N-acyltransferase, anticorps bile acid-Coenzyme A: amino acid N-acyltransferase, anticorps bile acid CoA:amino acid N-acyltransferase, anticorps BAAT, anticorps RPIC_RS10270, anticorps Bcav_2277, anticorps Rpic12D_1765, anticorps Baat, anticorps LOC481635, anticorps LOC100054567, anticorps LOC786798

Sujet: BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA).

Poids moléculaire: 46 kDa (MW of target protein)