PARP9 anticorps
-
- Antigène Voir toutes PARP9 Anticorps
- PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PARP9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PARP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI
- Top Product
- Discover our top product PARP9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PARP9 Blocking Peptide, catalog no. 33R-5013, is also available for use as a blocking control in assays to test for specificity of this PARP9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))
- Autre désignation
- PARP9 (PARP9 Produits)
- Synonymes
- anticorps RGD1307534, anticorps ARTD9, anticorps BAL, anticorps BAL1, anticorps MGC:7868, anticorps AW214463, anticorps BC003281, anticorps Bagl, anticorps Bal, anticorps PARP-9, anticorps poly (ADP-ribose) polymerase family, member 9, anticorps poly(ADP-ribose) polymerase family member 9, anticorps si:ch211-219a4.6, anticorps Parp9, anticorps PARP9, anticorps si:ch211-219a4.6
- Sujet
- PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown.
- Poids moléculaire
- 96 kDa (MW of target protein)
-