ALG2 anticorps

N° du produit ABIN631449

Détail du produit anti-ALG2 anticorps

Antigène: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALG2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ALG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALG2 Blocking Peptide, catalog no. 33R-7721, is also available for use as a blocking control in assays to test for specificity of this ALG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALG2

Antigène: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Autre désignation: ALG2 (ALG2 Produits)

Synonymes: anticorps CDGIi, anticorps NET38, anticorps hALPG2, anticorps 1110018A23Rik, anticorps 1300013N08Rik, anticorps ALPG2, anticorps MNCb-5081, anticorps im:7145131, anticorps ALG2, alpha-1,3/1,6-mannosyltransferase, anticorps asparagine-linked glycosylation 2 (alpha-1,3-mannosyltransferase), anticorps ALG2, alpha-1,3/1,6-mannosyltransferase L homeolog, anticorps GDP-Man:Man(1)GlcNAc(2)-PP-dolichol alpha-1,3-mannosyltransferase, anticorps ALG2, anticorps Alg2, anticorps alg2.L, anticorps alg2

Sujet: ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).

Poids moléculaire: 47 kDa (MW of target protein)