Clavesin 1 anticorps (Middle Region)

N° du produit ABIN631450

Détail du produit anti-Clavesin 1 anticorps

Antigène: Clavesin 1 (CLVS1)

Épitope: Middle Region

Reactivité: Rat, Souris, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Clavesin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RLBP1 L1 antibody was raised against the middle region of RLBP1 1

Purification: Affinity purified

Immunogène: RLBP1 L1 antibody was raised using the middle region of RLBP1 1 corresponding to a region with amino acids MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RLBP1L1 Blocking Peptide, catalog no. 33R-5996, is also available for use as a blocking control in assays to test for specificity of this RLBP1L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RLBP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Clavesin 1

Antigène: Clavesin 1 (CLVS1)

Autre désignation: RLBP1L1 (CLVS1 Produits)

Synonymes: anticorps RLBP1L1, anticorps rlbp1l1, anticorps CRALBPL, anticorps 4933402J24Rik, anticorps Clvl1, anticorps Rlbp1l1, anticorps Clavesin-1, anticorps RGD1564200, anticorps clavesin 1, anticorps clavesin 1 L homeolog, anticorps CLVS1, anticorps clvs1.L, anticorps Clvs1

Sujet: RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas.

Poids moléculaire: 41 kDa (MW of target protein)