BLMH anticorps (Middle Region)
-
- Antigène Voir toutes BLMH Anticorps
- BLMH (Bleomycin Hydrolase (BLMH))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BLMH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BLMH antibody was raised against the middle region of BLMH
- Purification
- Affinity purified
- Immunogène
- BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL
- Top Product
- Discover our top product BLMH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BLMH Blocking Peptide, catalog no. 33R-2825, is also available for use as a blocking control in assays to test for specificity of this BLMH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLMH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BLMH (Bleomycin Hydrolase (BLMH))
- Autre désignation
- BLMH (BLMH Produits)
- Synonymes
- anticorps AI035728, anticorps Bh, anticorps Bmh, anticorps wu:fb13c01, anticorps zgc:66261, anticorps bh, anticorps bmh, anticorps BH, anticorps BMH, anticorps bleomycin hydrolase, anticorps Bleomycin hydrolase, anticorps bleomycin hydrolase S homeolog, anticorps BLMH, anticorps pepC, anticorps LOC5569945, anticorps Apre_0140, anticorps Apar_0899, anticorps Smon_1289, anticorps Kfla_1242, anticorps Snas_3912, anticorps BLJ_1941, anticorps Olsu_1085, anticorps PGTDC60_0106, anticorps Blmh, anticorps blmh, anticorps blmh.S
- Sujet
- The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.
- Poids moléculaire
- 52 kDa (MW of target protein)
-