ALOX15B anticorps (N-Term)

N° du produit ABIN631457

Détail du produit anti-ALOX15B anticorps

Antigène: ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALOX15B est non-conjugé

Application: Western Blotting (WB)

Specificité: ALOX15 B antibody was raised against the N terminal of ALOX15

Purification: Affinity purified

Immunogène: ALOX15 B antibody was raised using the N terminal of ALOX15 corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALOX15B Blocking Peptide, catalog no. 33R-5636, is also available for use as a blocking control in assays to test for specificity of this ALOX15B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALOX15B

Antigène: ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))

Autre désignation: ALOX15B (ALOX15B Produits)

Synonymes: anticorps 15-LOX-2, anticorps ALOX15B, anticorps arachidonate 15-lipoxygenase, type B, anticorps arachidonate 15-lipoxygenase B, anticorps ALOX15B, anticorps Alox15b, anticorps LOC100525835

Sujet: ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.

Poids moléculaire: 67 kDa (MW of target protein)