MYH10 anticorps (N-Term)

N° du produit ABIN631458

Détail du produit anti-MYH10 anticorps

Antigène: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYH10 est non-conjugé

Application: Western Blotting (WB)

Specificité: MYH10 antibody was raised against the N terminal of MYH10

Purification: Affinity purified

Immunogène: MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYH10 Blocking Peptide, catalog no. 33R-9945, is also available for use as a blocking control in assays to test for specificity of this MYH10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYH10

Antigène: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Autre désignation: MYH10 (MYH10 Produits)

Synonymes: anticorps 5730504C04Rik, anticorps 9330167F11Rik, anticorps Fltn, anticorps Myhn-2, anticorps Myhn2, anticorps NMHC II-B, anticorps NMHC-B, anticorps NMHCII-B, anticorps NMMHC II-b, anticorps NMMHC-B, anticorps NMMHC-IIB, anticorps SMemb, anticorps mKIAA3005, anticorps MCH-B, anticorps nmmhcb, anticorps myosin, anticorps myosin-10, anticorps non-muscle, anticorps NMMHCB, anticorps dZ204D19.2, anticorps si:dz150i12.3, anticorps wu:fc46h07, anticorps wu:fy19d11, anticorps myosin, heavy polypeptide 10, non-muscle, anticorps myosin heavy chain 10, anticorps myosin, heavy chain 10, non-muscle S homeolog, anticorps myosin, heavy chain 10, non-muscle, anticorps Myh10, anticorps myh10.S, anticorps MYH10, anticorps myh10

Sujet: MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.

Poids moléculaire: 229 kDa (MW of target protein)