OSBPL3 anticorps (N-Term)

N° du produit ABIN631463

Détail du produit anti-OSBPL3 anticorps

Antigène: OSBPL3 (Oxysterol Binding Protein-Like 3 (OSBPL3))

Épitope: N-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OSBPL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: OSBPL3 antibody was raised against the N terminal of OSBPL3

Purification: Affinity purified

Immunogène: OSBPL3 antibody was raised using the N terminal of OSBPL3 corresponding to a region with amino acids MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OSBPL3 Blocking Peptide, catalog no. 33R-6237, is also available for use as a blocking control in assays to test for specificity of this OSBPL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OSBPL3

Antigène: OSBPL3 (Oxysterol Binding Protein-Like 3 (OSBPL3))

Autre désignation: OSBPL3 (OSBPL3 Produits)

Synonymes: anticorps osbpl3, anticorps zgc:101089, anticorps OSBPL3, anticorps ORP-3, anticorps ORP3, anticorps OSBP3, anticorps 1200014M06Rik, anticorps 6720421I08Rik, anticorps A530055M08, anticorps RGD1564287, anticorps oxysterol binding protein like 3, anticorps oxysterol binding protein-like 3a, anticorps oxysterol binding protein-like 3, anticorps OSBPL3, anticorps osbpl3a, anticorps osbpl3, anticorps Osbpl3

Sujet: This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.

Poids moléculaire: 98 kDa (MW of target protein)