OSBPL9 anticorps (N-Term)

N° du produit ABIN631464

Détail du produit anti-OSBPL9 anticorps

Antigène: OSBPL9 (Oxysterol Binding Protein-Like 9 (OSBPL9))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OSBPL9 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: OSBPL9 antibody was raised against the N terminal of OSBPL9

Purification: Affinity purified

Immunogène: OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OSBPL9 Blocking Peptide, catalog no. 33R-3831, is also available for use as a blocking control in assays to test for specificity of this OSBPL9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OSBPL9

Antigène: OSBPL9 (Oxysterol Binding Protein-Like 9 (OSBPL9))

Autre désignation: OSBPL9 (OSBPL9 Produits)

Synonymes: anticorps OSBPL9, anticorps osbpl9, anticorps MGC145585, anticorps ORP-9, anticorps DKFZp469M1123, anticorps ORP9, anticorps zgc:154069, anticorps 2600011I06Rik, anticorps AU015843, anticorps Orp-9, anticorps oxysterol binding protein-like 9, anticorps oxysterol binding protein like 9, anticorps oxysterol-binding protein-related protein 9, anticorps oxysterol binding protein like 9 L homeolog, anticorps Osbpl9, anticorps OSBPL9, anticorps Tsp_05293, anticorps LOC578365, anticorps osbpl9, anticorps osbpl9.L

Sujet: OSBPL9 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain.

Poids moléculaire: 61 kDa (MW of target protein)