TUBA4A anticorps (Middle Region)
-
- Antigène Voir toutes TUBA4A Anticorps
- TUBA4A (Tubulin, alpha 4a (TUBA4A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis, C. elegans
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TUBA4A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4
- Purification
- Affinity purified
- Immunogène
- alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH
- Top Product
- Discover our top product TUBA4A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
alpha Tubulin 4A Blocking Peptide, catalog no. 33R-3301, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TUBA4A (Tubulin, alpha 4a (TUBA4A))
- Autre désignation
- alpha Tubulin 4A (TUBA4A Produits)
- Synonymes
- anticorps TUBA1, anticorps TUBA6, anticorps H2-ALPHA, anticorps M[a]4, anticorps Tuba4, anticorps tuba1, anticorps tubulin alpha 1a, anticorps tubulin alpha 4a, anticorps tubulin, alpha 4A, anticorps tubulin alpha 4a L homeolog, anticorps TUBA1A, anticorps TUBA4A, anticorps Tuba4a, anticorps tuba4a.L
- Sujet
- Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.
- Poids moléculaire
- 50 kDa (MW of target protein)
- Pathways
- Dynamique des Microtubules, M Phase
-