GID4 anticorps (C-Term)

N° du produit ABIN631498

Détail du produit anti-GID4 anticorps

Antigène: GID4 (GID Complex Subunit 4, VID24 Homolog (GID4))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GID4 est non-conjugé

Application: Western Blotting (WB)

Specificité: C17 ORF39 antibody was raised against the C terminal Of C17 rf39

Purification: Affinity purified

Immunogène: C17 ORF39 antibody was raised using the C terminal Of C17 rf39 corresponding to a region with amino acids WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17ORF39 Blocking Peptide, catalog no. 33R-9936, is also available for use as a blocking control in assays to test for specificity of this C17ORF39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GID4

Antigène: GID4 (GID Complex Subunit 4, VID24 Homolog (GID4))

Autre désignation: C17ORF39 (GID4 Produits)

Synonymes: anticorps C17orf39, anticorps VID24, anticorps 4933439F18Rik, anticorps GID complex subunit 4 homolog, anticorps GID complex subunit 4, VID24 homolog, anticorps GID4, anticorps Gid4

Sujet: The function of C17orf39 protein has not been widely studied, and is yet to be fully elucidated. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors.

Poids moléculaire: 33 kDa (MW of target protein)