PAOX anticorps
-
- Antigène Voir toutes PAOX Anticorps
- PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAOX est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD
- Top Product
- Discover our top product PAOX Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PAOX Blocking Peptide, catalog no. 33R-4825, is also available for use as a blocking control in assays to test for specificity of this PAOX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAOX antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))
- Autre désignation
- PAOX (PAOX Produits)
- Synonymes
- anticorps PAO, anticorps mpao1, anticorps 2410012F02Rik, anticorps AI118225, anticorps Pao, anticorps pao, anticorps polyamine oxidase, anticorps polyamine oxidase 1, anticorps amine oxidase family protein, anticorps si:dkey-275b16.2, anticorps polyamine oxidase (exo-N4-amino), anticorps polyamine oxidase (exo-N4-amino) L homeolog, anticorps PAOX, anticorps pao1, anticorps NFIA_077590, anticorps POPTR_0011s12590g, anticorps si:dkey-275b16.2, anticorps Paox, anticorps paox.L
- Sujet
- PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.
- Poids moléculaire
- 25 kDa (MW of target protein)
-