Cytokeratin 7 anticorps (N-Term)
-
- Antigène Voir toutes Cytokeratin 7 (KRT7) Anticorps
- Cytokeratin 7 (KRT7) (Keratin 7 (KRT7))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cytokeratin 7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cytokeratin 7 antibody was raised against the N terminal of KRT7
- Purification
- Affinity purified
- Immunogène
- Cytokeratin 7 antibody was raised using the N terminal of KRT7 corresponding to a region with amino acids SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
- Top Product
- Discover our top product KRT7 Anticorps primaire
-
anti-Keratin 7 (KRT7) (AA 251-350) antibody
KRT7 Reactivité: Humain, Souris WB, FACS, IHC (p), ELISA, IHC (fro), IF (cc), IF (p) Hôte: Lapin Polyclonal unconjugated
anti-Keratin 7 (KRT7) (AA 91-394) antibodyKRT7 Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Keratin 7 (KRT7) (AA 394-457) antibodyKRT7 Reactivité: Rat WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Keratin 7 (KRT7) (AA 1-94) antibodyKRT7 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Keratin 7 (KRT7) (AA 2-469) antibodyKRT7 Reactivité: Humain WB, IHC, IF, ELISA, IP Hôte: Lapin Polyclonal unconjugated
anti-Keratin 7 (KRT7) antibodyKRT7 Reactivité: Humain WB, IHC, FACS, StM Hôte: Souris Monoclonal rOV-TL12-30 unconjugated Recombinant Antibody
anti-Keratin 7 (KRT7) antibodyKRT7 Reactivité: Humain, Rat IHC, IF, FACS, StM Hôte: Souris Monoclonal KRT7-760-OV-TL12-30 unconjugated
anti-Keratin 7 (KRT7) antibodyKRT7 Reactivité: Humain IHC, IF, FACS, StM Hôte: Souris Monoclonal KRT7-903 unconjugated
anti-Keratin 7 (KRT7) antibodyKRT7 Reactivité: Humain WB, IHC, FACS, StM, ISt Hôte: Lapin Monoclonal KRT7-1499R unconjugated
anti-Keratin 7 (KRT7) antibodyKRT7 Reactivité: Humain WB, IHC, IF, ELISA, IP Hôte: Souris Monoclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cytokeratin 7 Blocking Peptide, catalog no. 33R-8529, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cytokeratin 7 (KRT7) (Keratin 7 (KRT7))
- Autre désignation
- Cytokeratin 7 (KRT7 Produits)
- Synonymes
- anticorps CK7, anticorps K2C7, anticorps K7, anticorps SCL, anticorps D15Wsu77e, anticorps Krt2-7, anticorps KRT7, anticorps keratin 7, anticorps KRT7, anticorps Krt7
- Sujet
- KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13.
- Poids moléculaire
- 52 kDa (MW of target protein)
-
