PPIL3 anticorps
-
- Antigène Voir toutes PPIL3 Anticorps
- PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPIL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
- Top Product
- Discover our top product PPIL3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPIL3 Blocking Peptide, catalog no. 33R-6948, is also available for use as a blocking control in assays to test for specificity of this PPIL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))
- Autre désignation
- PPIL3 (PPIL3 Produits)
- Synonymes
- anticorps MGC89451, anticorps CYPJ, anticorps Cyp10l, anticorps 2310076N22Rik, anticorps 2510026K04Rik, anticorps peptidylprolyl isomerase like 3, anticorps peptidylprolyl isomerase (cyclophilin)-like 3, anticorps ppil3, anticorps PPIL3, anticorps Ppil3
- Sujet
- This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolylimide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants.
- Poids moléculaire
- 18 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-