POLR1B anticorps
-
- Antigène Voir toutes POLR1B Anticorps
- POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp POLR1B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- POLR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD
- Top Product
- Discover our top product POLR1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
POLR1B Blocking Peptide, catalog no. 33R-8358, is also available for use as a blocking control in assays to test for specificity of this POLR1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))
- Autre désignation
- POLR1B (POLR1B Produits)
- Synonymes
- anticorps RPOL-1l, anticorps MGC68946, anticorps 128kDa, anticorps D630020H17Rik, anticorps RPA116, anticorps RPA135, anticorps RPA2, anticorps Rpo1-2, anticorps RNA polymerase I subunit B, anticorps polymerase (RNA) I polypeptide B L homeolog, anticorps polymerase (RNA) I polypeptide B, 128kDa, anticorps polymerase (RNA) I polypeptide B, anticorps DNA-directed RNA polymerase I subunit RPA2, anticorps POLR1B, anticorps polr1b.L, anticorps polr1b, anticorps LOC100563266, anticorps LOC100634236, anticorps Polr1b
- Sujet
- Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species.
- Poids moléculaire
- 128 kDa (MW of target protein)
-