DDT anticorps (N-Term)

N° du produit ABIN631517

Détail du produit anti-DDT anticorps

Antigène: DDT (D-Dopachrome Tautomerase (DDT))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDT est non-conjugé

Application: Western Blotting (WB)

Specificité: DDT antibody was raised against the N terminal of DDT

Purification: Affinity purified

Immunogène: DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDT Blocking Peptide, catalog no. 33R-7078, is also available for use as a blocking control in assays to test for specificity of this DDT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDT

Antigène: DDT (D-Dopachrome Tautomerase (DDT))

Autre désignation: DDT (DDT Produits)

Synonymes: anticorps ddt-b, anticorps zgc:86714, anticorps wu:fb49f11, anticorps C78655, anticorps DDT, anticorps ddt, anticorps ddt-a, anticorps DDCT, anticorps D-dopachrome tautomerase L homeolog, anticorps D-dopachrome tautomerase, anticorps D-dopachrome tautomerase S homeolog, anticorps ddt.L, anticorps DDT, anticorps ddt, anticorps Ddt, anticorps ddt.S

Sujet: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. It is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.

Poids moléculaire: 13 kDa (MW of target protein)