Cytokeratin 19 anticorps (N-Term)
-
- Antigène Voir toutes Cytokeratin 19 (KRT19) Anticorps
- Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cytokeratin 19 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cytokeratin 19 antibody was raised against the N terminal of KRT19
- Purification
- Affinity purified
- Immunogène
- Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids TSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSAR
- Top Product
- Discover our top product KRT19 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cytokeratin 19 Blocking Peptide, catalog no. 33R-9308, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
- Autre désignation
- Cytokeratin 19 (KRT19 Produits)
- Synonymes
- anticorps CK19, anticorps K19, anticorps K1CS, anticorps AI663979, anticorps EndoC, anticorps Krt-1.19, anticorps Krt1-19, anticorps Ka19, anticorps k19, anticorps ck19, anticorps k1cs, anticorps krt9, anticorps krt15, anticorps MGC76282, anticorps GK-19, anticorps MGC83069, anticorps KRT19, anticorps keratin 19, anticorps keratin 19 L homeolog, anticorps keratin, type I cytoskeletal 19, anticorps KRT19, anticorps Krt19, anticorps krt19, anticorps krt19.L, anticorps LOC100344434, anticorps LOC101117946
- Sujet
- KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis.
- Poids moléculaire
- 44 kDa (MW of target protein)
-