KRT23 anticorps

N° du produit ABIN631521

Détail du produit anti-KRT23 anticorps

Antigène: KRT23 (Keratin 23 (KRT23))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRT23 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Cytokeratin 23 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 23 Blocking Peptide, catalog no. 33R-4032, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KRT23

Antigène: KRT23 (Keratin 23 (KRT23))

Autre désignation: Cytokeratin 23 (KRT23 Produits)

Synonymes: anticorps CK23, anticorps HAIK1, anticorps K23, anticorps Haik1, anticorps Krt1-23, anticorps Ka23, anticorps keratin 23, anticorps type II keratin 23, anticorps KRT23, anticorps Krt23, anticorps Kb23

Sujet: KRT23 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains.

Poids moléculaire: 48 kDa (MW of target protein)