PPP2R5A anticorps (N-Term)
-
- Antigène Voir toutes PPP2R5A Anticorps
- PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP2R5A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PPP2 R2 antibody was raised against the N terminal of PPP2 2
- Purification
- Affinity purified
- Immunogène
- PPP2 R2 antibody was raised using the N terminal of PPP2 2 corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW
- Top Product
- Discover our top product PPP2R5A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP2R5A Blocking Peptide, ABIN936266, is also available for use as a blocking control in assays to test for specificity of this PPP2R5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))
- Autre désignation
- PPP2R5A (PPP2R5A Produits)
- Sujet
- PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Signalisation PI3K-Akt
-