PPP2R5A anticorps (N-Term)

N° du produit ABIN631523

Détail du produit anti-PPP2R5A anticorps

Antigène: PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))

Épitope: N-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP2R5A est non-conjugé

Application: Western Blotting (WB)

Specificité: PPP2 R2 antibody was raised against the N terminal of PPP2 2

Purification: Affinity purified

Immunogène: PPP2 R2 antibody was raised using the N terminal of PPP2 2 corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP2R5A Blocking Peptide, ABIN936266, is also available for use as a blocking control in assays to test for specificity of this PPP2R5A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP2R5A

Antigène: PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))

Autre désignation: PPP2R5A (PPP2R5A Produits)

Synonymes: anticorps PR61alpha, anticorps B56A, anticorps PR61A, anticorps si:dkey-18c8.1, anticorps protein phosphatase 2 regulatory subunit B'alpha, anticorps protein phosphatase 2, regulatory subunit B', alpha, anticorps protein phosphatase 2 regulatory subunit B', alpha, anticorps protein phosphatase 2, regulatory subunit B', alpha isoform, anticorps PPP2R5A, anticorps Ppp2r5a, anticorps ppp2r5a.S, anticorps ppp2r5a

Sujet: PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt